PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10012991m
Common NameCARUB_v10012991mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 818aa    MW: 92965 Da    PI: 5.5549
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10012991mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.91.1e-08454498246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g+WT+ Ed+ l + +++ G  +W  Ia  +g++Rt+ qc  r+q 
  Carubv10012991m 454 GPWTEAEDKNLPRIIEEKGLTDWVEIAVSLGTNRTPFQCLARYQR 498
                      89*****************************************96 PP

2Myb_DNA-binding43.86.1e-14506550146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+ WT+eEd++l  av+++G ++W ++a+ +  gR + qc +rw k
  Carubv10012991m 506 RKEWTPEEDDQLRAAVELFGDKDWQSVANVLK-GRAGTQCSNRWKK 550
                      789****************************9.***********98 PP

3Myb_DNA-binding53.36.5e-17557602147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +grW+ eEd++ + av+++G+ +W++I++ ++ gRt+ qc++rw + 
  Carubv10012991m 557 KGRWSLEEDKRVKVAVTLFGSQNWHKISQFVP-GRTATQCRERWVNC 602
                      79******************************.***********986 PP

4Myb_DNA-binding46.58.8e-15609653147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+WT+eEde+l++a+ ++G   W+++a+++   Rt++qc  rw ++
  Carubv10012991m 609 RGKWTEEEDEKLKEAIGKHGYS-WSKVASHLA-CRTDNQCLRRWKTL 653
                      89******************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.879354447IPR017877Myb-like domain
SMARTSM0071724358449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-5361377IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-5423459IPR009057Homeodomain-like
SuperFamilySSF466894.77E-11446503IPR009057Homeodomain-like
PROSITE profilePS500909.291448500IPR017877Myb-like domain
SMARTSM007179.6E-10452502IPR001005SANT/Myb domain
PfamPF002493.9E-8454498IPR001005SANT/Myb domain
CDDcd001672.40E-6455500No hitNo description
Gene3DG3DSA:1.10.10.601.8E-12460512IPR009057Homeodomain-like
SuperFamilySSF466895.52E-20485555IPR009057Homeodomain-like
PROSITE profilePS5129422.559501556IPR017930Myb domain
SMARTSM007172.6E-13505554IPR001005SANT/Myb domain
PfamPF002495.1E-13506550IPR001005SANT/Myb domain
CDDcd001679.03E-11508552No hitNo description
Gene3DG3DSA:1.10.10.602.1E-16513554IPR009057Homeodomain-like
SMARTSM007175.2E-14556605IPR001005SANT/Myb domain
PfamPF002495.1E-15557602IPR001005SANT/Myb domain
PROSITE profilePS5129413.459557603IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-20558607IPR009057Homeodomain-like
CDDcd001677.10E-11559601No hitNo description
SuperFamilySSF466891.11E-25583658IPR009057Homeodomain-like
PROSITE profilePS5129427.078604658IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-20608654IPR009057Homeodomain-like
SMARTSM007171.1E-13608656IPR001005SANT/Myb domain
PfamPF002491.4E-13609653IPR001005SANT/Myb domain
CDDcd001672.64E-11611653No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 818 aa     Download sequence    Send to blast
MNRNSLYEAY GDDDDDDEDD IGEELEELRQ ACMVAGANSN EFSAKTNSIE ADGGGGGEMP  60
SDSEDEDDLM LRTISSQLAP SKDADLSGGP PIGLSLPSDS DSEDDFEMIR NITSQLALPM  120
DVPLPRIGLS DDDDEDEDFE TIRVIRRRFS AYDSEANFGN DSLGKKKQVH DLDNEPSREI  180
LSRSNTCESF PDHGKSVVTV PDSEDVRDGH SVDVHDITST EPLDHLDTSQ LSLMPAASST  240
FPEAAQAFVD AIRKNRAYQK FLRRKLEVIE ATIEQNEKHR KNVKIVKDFQ ASCKRRTKLA  300
LSQRKDPRVE LISARKCVPC DSSEGNDKKT SPLMLGPPEN PFVAKYRMAL EKYPVSVERR  360
NWSTEENKNL AKGLKQEVQK ILLYEAIEQS RDLEDSTYDI DTINESIRNL EITPEMIRQF  420
LPKINWDSLD IKDRSAAECE ARWMSSEDPL INHGPWTEAE DKNLPRIIEE KGLTDWVEIA  480
VSLGTNRTPF QCLARYQRSL NPSILRKEWT PEEDDQLRAA VELFGDKDWQ SVANVLKGRA  540
GTQCSNRWKK SLRPTRKGRW SLEEDKRVKV AVTLFGSQNW HKISQFVPGR TATQCRERWV  600
NCLEPKVNRG KWTEEEDEKL KEAIGKHGYS WSKVASHLAC RTDNQCLRRW KTLYPHQVVL  660
LQQARRLRKE AIVGNFVDRE SERPALVTGA ILALPEISLE PDPDSVALKN KRKAKQRKSD  720
AERQPKRRRK GLEKCSGDVI RQENATVCEK EPNNGGEEKS LELERYNEIQ DNAKEKQRRS  780
RKRVAETPNN TTGLRKLTPR RKKVSAVVPI KNQDALN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-294156509159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-294156509159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1710728KRKAKQRKSDAERQPKRRR
2780802RKRVAETPNNTTGLRKLTPRRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0338270.0AY033827.1 Arabidopsis thaliana putative transcription factor (MYB4R1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296998.10.0hypothetical protein CARUB_v10012991mg
TrEMBLR0G3G90.0R0G3G9_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__2002__AT3G18100.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65042744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1